Skip to content

Issues: brettc/partitionfinder

New issue

Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.

Sign up for GitHub

By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.

Already on GitHub? Sign in to your account

18 Open 87 Closed
18 Open 87 Closed
Author
Filter by author
Loading
Label
Filter by label
Loading
Use alt + click/return to exclude labels
or ⇧ + click/return for logical OR
Projects
Filter by project
Loading
Milestones
Filter by milestone
Loading
Assignee
Filter by who’s assigned
Sort
Sort by
Newest Oldest Most commented Least commented Recently updated Least recently updated Best match
Most reactions
👍 👎 😄 🎉 😕 ❤️ 🚀 👀

Issues list

ERROR: Bad base (Q) at site 15 of sequence 1 Printing error context: 6 MYDSYVDDKVGHVTQIIGPVVDIAFSSNKMPNIYN Problem reading alignment file
#138 opened Nov 25, 2020 by xiongqian123456789
2
Running ~20 loci dataset
#136 opened Mar 24, 2020 by aberaslop
1
Error about working directory via
#135 opened Dec 18, 2019 by zhounan1356
1
Error 522 to download anaconda
#134 opened Sep 10, 2019 by glichtenstein
1
Link to the example dataset in the tutorial is broken
#133 opened Aug 20, 2019 by joelnitta
PartitionFinderProtein error: Failed to run models ...; not sure why
#132 opened Feb 24, 2019 by dongzhang0725
user_tree_topology handling
#131 opened Jan 10, 2019 by carloliveros
Manual in Chinese
#128 opened Apr 1, 2018 by roblanf
HDF5 error
#127 opened Oct 2, 2017 by roblanf
1
buffer size issue
#124 opened Apr 19, 2017 by roblanf
10
check_state_probs needs some tests
#72 opened Oct 1, 2015 by brettc PF2.0 Beta
Installations on windows network drives seem to fail
#48 opened Jul 9, 2015 by brettc
Consider packaging / distribution for 2.0 (maybe using a Conda recipe)
#38 opened Feb 5, 2015 by brettc
2
Allow for relocation of output folder
#34 opened Feb 2, 2015 by brettc
Check error handling in threading
#33 opened Feb 1, 2015 by brettc
Order of clustering steps can differ on different machines, even in reruns
#13 opened Feb 20, 2014 by cmayer
1
Catch segmentation faults from RAxML / PhyML
#11 opened Feb 18, 2014 by roblanf
very small datablocks with RAxML
#6 opened Jun 16, 2013 by roblanf
ProTip! Adding no:label will show everything without a label.